PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008240291.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family WOX
Protein Properties Length: 403aa    MW: 45597.9 Da    PI: 8.1807
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008240291.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox69.34.8e-2291150357
                     --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
        Homeobox   3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                     +R+++t+eql++Leel+++ +r+psae++++++++l    +++ ++V++WFqN++a+e++
  XP_008240291.1  91 SRWNPTPEQLRALEELYRRgTRTPSAEQIQHITAQLrkygKIEGKNVFYWFQNHKARERQ 150
                     7*****************99**************************************97 PP

2Wus_type_Homeobox115.42.7e-3790152365
  Wus_type_Homeobox   3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                        ++RW+PtpeQ++ Leely++G+rtP++e+iq+ita+L++yGkie+kNVfyWFQN+kaRerqk+
     XP_008240291.1  90 SSRWNPTPEQLRALEELYRRGTRTPSAEQIQHITAQLRKYGKIEGKNVFYWFQNHKARERQKR 152
                        79***********************************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003891.6E-588155IPR001356Homeobox domain
SuperFamilySSF466891.11E-1291157IPR009057Homeodomain-like
PfamPF000469.7E-2091150IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.6E-991150IPR009057Homeodomain-like
CDDcd000861.79E-692152No hitNo description
PROSITE profilePS5007111.22496151IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048513Biological Processanimal organ development
GO:0099402Biological Processplant organ development
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 403 aa     Download sequence    Send to blast
MWMMGYNESG HADFNMPDSF NGRKLRPLIP RPLVPSANNA TSSVTAATPP CLNRIHGVSH  60
DFFTQYHHLA AMAEQNKRSE FINTPQVVVS SRWNPTPEQL RALEELYRRG TRTPSAEQIQ  120
HITAQLRKYG KIEGKNVFYW FQNHKARERQ KRRRQMESSV PSVQPDHEIS LSSTDHQKKE  180
SLGASRTVFE VEQTKNWAPS TNCSTTLAEE SVSIQRAAKA AVAATECRTD GWIQFDEEEL  240
QQRRNFVERN ATWQMMQLSC PPPPSPLPPQ YPHLPTHLII NTPTCSTANS NSTDNLTSSR  300
ASRAATVRTV DQRLIKGHDL SILLTPYSSI SEESGFINFN HPNHNTNVEQ DHGCGESQTL  360
QLFPLRSGHA NANANLEKDH AELSANFSRA QPYPFFEFLP LKN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ2912504e-52JQ291250.1 Lotus japonicus NARROW ORGAN 1 (NAO1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008240291.10.0PREDICTED: WUSCHEL-related homeobox 1
TrEMBLM5WDG70.0M5WDG7_PRUPE; Uncharacterized protein
STRINGGLYMA05G33850.21e-141(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF28923471
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18010.11e-63WUSCHEL related homeobox 1